TRMT9B Antibody - N-terminal region : Biotin

TRMT9B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57469_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human K1456

Key Reference: N/A

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: CGTGKYLKVNSQVHTVGCDYCGPLVEIARNRGCEAMVCDNLNLPFRDEGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: probable tRNA methyltransferase 9B

Protein Size: 454

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57469_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57469_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57604
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×