TRPC4AP Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPC4AP

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short transient receptor potential channel 4-associated protein

Protein Size: 797

Purification: Affinity Purified

• Artikelnummer: AVIARP55313_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55313_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26133
• Wirt: Rabbit