TSPAN33 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN33

Key Reference: Heikens,M.J., (2007) Blood 109 (8), 3244-3252

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetraspanin-33

Protein Size: 283

Purification: Affinity Purified

• Artikelnummer: AVIARP55781_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55781_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 340348
• Wirt: Rabbit