TSTA3 Antibody - N-terminal region : Biotin

TSTA3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58679_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TSTA3

Key Reference: Roos,C., (2002) J. Biol. Chem. 277 (5), 3168-3175

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GDP-L-fucose synthase

Protein Size: 321

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58679_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58679_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7264
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×