TTC9C Antibody - N-terminal region : FITC

TTC9C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55705_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC9C

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetratricopeptide repeat protein 9C

Protein Size: 171

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55705_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55705_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283237
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×