TWF1 Antibody - N-terminal region : Biotin

TWF1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56487_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TWF1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 384

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56487_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56487_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5756
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×