TWF1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TWF1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 384

Purification: Affinity Purified

• Artikelnummer: AVIARP56487_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56487_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5756
• Wirt: Rabbit