English
TXN2 Antibody - middle region : Biotin
TXN2 Antibody - middle region : Biotin
Artikelnummer
AVIARP54909_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXN2
Key Reference: Benhar,M., (2008) Science 320 (5879), 1050-1054
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thioredoxin, mitochondrial
Protein Size: 166
Purification: Affinity Purified
Description of Target: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXN2
Key Reference: Benhar,M., (2008) Science 320 (5879), 1050-1054
Molecular Weight: 18kDa
Peptide Sequence: Synthetic peptide located within the following region: QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Thioredoxin, mitochondrial
Protein Size: 166
Purification: Affinity Purified
| Artikelnummer | AVIARP54909_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54909_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 25828 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
