English
TXNDC4 Antibody - middle region : HRP
TXNDC4 Antibody - middle region : HRP
Artikelnummer
AVIARP58726_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4
Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383
Molecular Weight: 45kDa
Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Endoplasmic reticulum resident protein 44
Protein Size: 406
Purification: Affinity Purified
Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4
Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383
Molecular Weight: 45kDa
Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Endoplasmic reticulum resident protein 44
Protein Size: 406
Purification: Affinity Purified
| Artikelnummer | AVIARP58726_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58726_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 23071 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
