UCHL5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5

Key Reference: Qiu,X.B., (2006) EMBO J. 25 (24), 5742-5753

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L5

Protein Size: 329

Purification: Affinity Purified

• Artikelnummer: AVIARP56797_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56797_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51377
• Wirt: Rabbit