UCHL5IP Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Key Reference: Hahn,Y. Hum. Genet. 119 (1-2), 169-178 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 427

Purification: Affinity Purified

Subunit: 7

• Artikelnummer: AVIARP56968_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56968_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55559
• Wirt: Rabbit