English
UQCRFS1 Antibody - N-terminal region : Biotin
UQCRFS1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58549_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1
Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial
Protein Size: 274
Purification: Affinity Purified
Subunit: Rieske, mitochondrial
Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1
Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial
Protein Size: 274
Purification: Affinity Purified
Subunit: Rieske, mitochondrial
| Artikelnummer | AVIARP58549_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58549_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 7386 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
