USP36 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP36

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 36

Protein Size: 1123

Purification: Affinity Purified

• Artikelnummer: AVIARP57666_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57666_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57602
• Wirt: Rabbit