UTY Antibody : Biotin

UTY Antibody : Biotin
Artikelnummer
AVIARP58214_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A large number of alternatively spliced transcripts have been observed for this gene, but the full length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Molecular Weight: 150 kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone demethylase UTY

Protein Size: 1347

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58214_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58214_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Human Gene ID 7404
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×