VGLL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL1

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription cofactor vestigial-like protein 1

Protein Size: 258

Purification: Affinity Purified

• Artikelnummer: AVIARP58041_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58041_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51442
• Wirt: Rabbit