VSIG1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG1

Key Reference: Scanlan,M.J., (er) Cancer Immun. 6, 2 (2006)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-set and immunoglobulin domain-containing protein 1

Protein Size: 387

Purification: Affinity Purified

• Artikelnummer: AVIARP55832_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55832_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 340547
• Wirt: Rabbit