WBP2 Antibody - N-terminal region : FITC

WBP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54911_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP2

Key Reference: Dhananjayan,S.C., (2006) Mol. Endocrinol. 20 (10), 2343-2354

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WW domain-binding protein 2

Protein Size: 261

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54911_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54911_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23558
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×