WDFY1 Antibody - N-terminal region : Biotin

WDFY1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57465_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains a single FYVE domain and multiple WD40 repeats. This protein is localized to endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDFY1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat and FYVE domain-containing protein 1

Protein Size: 410

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57465_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57465_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57590
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×