Wdfy1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: ASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wdfy1 Ensembl ENSMUSP00000109138 Ensembl ENSMUSP00000109139 Ensembl ENSMUSP00000040224

Protein Size: 187

Purification: Affinity Purified

• Artikelnummer: AVIARP57466_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57466_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 69368
• Wirt: Rabbit