English
WDR21A Antibody - middle region : HRP
WDR21A Antibody - middle region : HRP
Artikelnummer
AVIARP55298_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21A
Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: DDB1- and CUL4-associated factor 4 Ensembl ENSP00000377781
Protein Size: 395
Purification: Affinity Purified
Description of Target: WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21A
Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Molecular Weight: 43kDa
Peptide Sequence: Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: DDB1- and CUL4-associated factor 4 Ensembl ENSP00000377781
Protein Size: 395
Purification: Affinity Purified
| Artikelnummer | AVIARP55298_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55298_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 26094 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
