XAF1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XAF1

Key Reference: Bai,Y., (2008) J. Biol. Chem. 283 (11), 6832-6842

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: XIAP-associated factor 1

Protein Size: 301

Purification: Affinity Purified

• Artikelnummer: AVIARP56969_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56969_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54739
• Wirt: Rabbit