Zar1l Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zar1l

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SQLLLPTWSRDREEQFPRLKELGEEYAHSPQDRKGKQFLELKYGYFHCKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Zar1l Ensembl ENSMUSP00000114116

Protein Size: 291

Purification: Affinity Purified

• Artikelnummer: AVIARP58201_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58201_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 545824
• Wirt: Rabbit