Zcchc8 Antibody - C-terminal region : FITC

Zcchc8 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56986_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Zcchc8

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56986_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56986_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 288661
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×