ZDHHC24 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC24

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable palmitoyltransferase ZDHHC24

Protein Size: 284

Purification: Affinity Purified

• Artikelnummer: AVIARP55989_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55989_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 254359
• Wirt: Rabbit