ZNF134 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF134 is a candidate transcription factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF134

Key Reference: Tommerup,N. (1995) Genomics 27 (2), 259-264

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 134

Protein Size: 427

Purification: Affinity Purified

• Artikelnummer: AVIARP58103_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58103_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7693
• Wirt: Rabbit