ZNF334 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF334

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 334

Protein Size: 680

Purification: Affinity Purified

• Artikelnummer: AVIARP58055_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58055_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55713
• Wirt: Rabbit