ZNF764 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF764

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 764

Protein Size: 408

Purification: Affinity Purified

• Artikelnummer: AVIARP58137_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58137_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 92595
• Wirt: Rabbit