ZNF768 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ZNF768 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF768

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 768

Protein Size: 540

Purification: Affinity Purified

• Artikelnummer: AVIARP58118_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58118_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79724
• Wirt: Rabbit