ZP1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZP1

Key Reference: Gook,D.A., (2008) Hum. Reprod. 23 (2), 394-402

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zona pellucida sperm-binding protein 1

Protein Size: 638

Purification: Affinity Purified

• Artikelnummer: AVIARP55991_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55991_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22917
• Wirt: Rabbit