ACADSB Antibody - middle region : Biotin

ACADSB Antibody - middle region : Biotin
Artikelnummer
AVIARP54586_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. The ACADSB gene product has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs. The cDNA encodes for a mitochondrial precursor protein which is cleaved upon mitochondrial import and predicted to yield a mature peptide of approximately 43.7-kDa. Sequence Note: The 3' UTR extension represented by the RefSeq transcript record was derived from genomic sequence data to optimize consistency to the reference genome assembly. The extent of the UTR extension and the location of the polyA site was based on transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACADSB

Key Reference: Kamide,K., (2007) J. Hypertens. 25 (1), 103-110

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial

Protein Size: 432

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54586_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54586_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 36
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×