ACAP2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACAP2 is a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAP2

Key Reference: N/A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: ARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Protein Size: 778

Purification: Affinity purified

• Artikelnummer: AVIARP54874_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54874_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23527
• Wirt: Rabbit