Acbd3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA.

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi resident protein GCP60

Protein Size: 526

Purification: Affinity Purified

• Artikelnummer: AVIARP57650_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57650_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 289312
• Wirt: Rabbit