ACBD7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACBD7 binds medium- and long-chain acyl-CoA esters.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACBD7

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: KQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified

• Artikelnummer: AVIARP56266_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56266_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 414149
• Wirt: Rabbit