ACBD7 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD7

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified

• Artikelnummer: AVIARP56265_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56265_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 414149
• Wirt: Rabbit