ACD Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACD

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Adrenocortical dysplasia protein homolog

Protein Size: 544

Purification: Affinity Purified

• Artikelnummer: AVIARP58253_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58253_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 65057
• Wirt: Rabbit