ACO2 Antibody - C-terminal region : Biotin

ACO2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56302_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACO2

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aconitate hydratase, mitochondrial

Protein Size: 780

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56302_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56302_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 50
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×