ACOT4 Antibody - middle region : HRP

ACOT4 Antibody - middle region : HRP
Artikelnummer
AVIARP58412_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH By similarity. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACOT4

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: NALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH


Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-coenzyme A thioesterase 4

Protein Size: 421

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58412_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58412_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 122970
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×