Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)

Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
Artikelnummer
STRSPR-322B-A594
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Alpha Synuclein: ATTO 594

Nature: Recombinant

Swiss-Prot: P37840

Biological Activity: Under Investigation

Expression System: E. coli

Protein Length: Full Length

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: PBS pH7.4, 0.09% Azide

Protein Size: N/A

Conjugate: ATTO 594

Cellular Localization: Cytoplasm,Membrane,Nucleus

Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).

References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-322B-A594
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-322B-A594
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human
Methode Western Blotting, In Vivo Assay, SDS-PAGE
Human Gene ID 6622
Produktinformation (PDF)
×
MSDS (PDF) Download