English
ADGRG1 Antibody - N-terminal region : FITC
ADGRG1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58627_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPR56
Key Reference: Ke,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: adhesion G-protein coupled receptor G1
Protein Size: 693
Purification: Affinity Purified
Description of Target: This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPR56
Key Reference: Ke,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: adhesion G-protein coupled receptor G1
Protein Size: 693
Purification: Affinity Purified
| Artikelnummer | AVIARP58627_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58627_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Rabbit |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 9289 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
