ADGRG1 Antibody - N-terminal region : HRP

ADGRG1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58627_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPR56

Key Reference: Ke,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: adhesion G-protein coupled receptor G1

Protein Size: 693

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58627_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58627_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9289
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×