Agtpbp1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Agtpbp1 is a metallocarboxypeptidase that mediates deglutamylation of target proteins. It catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. It also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Agtpbp1 acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5. Deglutamylation plays a key role in cerebellar Purkinje cell differentiation, accumulation of tubulin polyglutamylation causing neurodegeneration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1

Molecular Weight: 128kDa

Peptide Sequence: Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 1160

Purification: Affinity Purified

• Artikelnummer: AVIARP55206_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55206_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 67269
• Wirt: Rabbit