Ahi1 Antibody - C-terminal region : HRP

Ahi1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56992_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe mental retardation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Jouberin

Protein Size: 1047

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56992_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56992_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 308923
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×