ALDH1A1 Antibody - middle region : Biotin

ALDH1A1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58737_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A1

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Retinal dehydrogenase 1

Protein Size: 501

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58737_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58737_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 216
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×