ALDH1B1 Antibody - middle region : FITC

ALDH1B1 Antibody - middle region : FITC
Artikelnummer
AVIARP58417_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1

Key Reference: Luo,P., (2007) Stem Cells 25 (10), 2628-2637

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldehyde dehydrogenase X, mitochondrial

Protein Size: 517

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58417_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58417_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×