ALDH1B1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1

Key Reference: Luo,P., (2007) Stem Cells 25 (10), 2628-2637

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Aldehyde dehydrogenase X, mitochondrial

Protein Size: 517

Purification: Affinity Purified

• Artikelnummer: AVIARP58417_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58417_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 219
• Wirt: Rabbit
• Konjugat: Conjugated, HRP