Aldh2 Antibody - C-terminal region : Biotin

Aldh2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58418_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Aldh2 is capable of converting retinaldehyde to retinoic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldehyde dehydrogenase, mitochondrial

Protein Size: 519

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58418_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58418_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11669
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×