Aldh2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aldh2 is capable of converting retinaldehyde to retinoic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldehyde dehydrogenase, mitochondrial

Protein Size: 519

Purification: Affinity Purified

• Artikelnummer: AVIARP58418_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58418_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11669
• Wirt: Rabbit