ALDH7A1 Antibody - N-terminal region : Biotin

ALDH7A1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57834_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. Mutations in this gene cause pyridoxine-dependent epilepsy, which involves a combination of various seizure types and is responsive to immediate administration of pyridoxine hydrochloride. Four additional human antiquitin-like sequences, all of which are pseudogenes, have also been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH7A1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase

Protein Size: 511

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57834_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57834_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 501
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×