Alpha Synuclein S129A Mutant Monomers

Human Recombinant Alpha Synuclein S129A Mutant Monomers
Artikelnummer
STRSPR-505E
Verpackungseinheit
5x100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Alpha Synuclein S129A

Nature: Recombinant

Swiss-Prot: P37840-1

Expression System: E. coli

Protein Length: Full length (1 - 140 aa)

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: 1X PBS pH7.4

Protein Size: 14.44 kDa

Conjugate: No Tag

Scientific Background: Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson’s disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]). Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2).Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.

References: 1. Xu, Deng and Qing. 2015. The phosphorylation of α-synuclein: development and implication for the mechanism and therapy of the Parkinson's disease. Journal of Neurochemistry. https://doi.org/10.1111/jnc.132342. Ramalingam et al. 2023. Dynamic physiological α-synuclein S129 phosphorylation is driven by neuronal activity. NPJ Parkinsons Dis. doi: 10.1038/s41531-023-00444-w.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-505E
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-505E
Green Labware Nein
Verpackungseinheit 5x100 µg
Mengeneinheit PAK
Reaktivität Human
Methode Western Blotting, In Vivo Assay
Produktinformation (PDF) Download
MSDS (PDF) Download