Amigo2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Amigo2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. It also may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Amphoterin-induced protein 2

Protein Size: 520

Purification: Affinity Purified

• Artikelnummer: AVIARP55810_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55810_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 300186
• Wirt: Rabbit